DPCfam | MC343896
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 151 ± 11 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7BS54 | 3-149 | 147 | LIIFVFAFIFTACKTAEILPYEVNPERFGKSANTVYENARLNQKKDAPTFGLSGQYEIMKGDKLVFEYIFVKEANPNIADDEFTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4UG25-F1 | 19-93 | 47.02 | 89.68 | View in AlphaFoldDB ↗ |