DPCfam | MC343862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3671 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Residues in low-complexity regions (%) | 16.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.38 |
| Average transmembrane regions | 3.2 |
| Dominant Pfam architecture(s) | PF01925 |
| Sequences matching dominant architecture (%) | 98.11 |
| Average overlap percent | 56.82 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R1DYV6 | 379-470 | 92 | MILGPIFVALDFQPQVGTATTGFMILFTAMGGTVKYLTIGKLSWQMFLWFAAVGAVGGQTGQRLVRRLIQRTGRPSYVVFLLGGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I6F3-F1 | 7-121 | 99.04 | 89.74 | View in AlphaFoldDB ↗ |