DPCfam | MC343563
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Residues in low-complexity regions (%) | 14.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 53.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00702 |
| Sequences matching dominant architecture (%) | 14.04 |
| Average overlap percent | 11.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1M449 | 115-206 | 92 | QSAELLGGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPTGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P97767-F1 | 276-354 | 97.53 | 69.78 | View in AlphaFoldDB ↗ |