DPCfam | MC34356
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 345 ± 35 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 13.27 |
| Average transmembrane regions | 2.66 |
| Dominant Pfam architecture(s) | PF00173- PF03142 |
| Sequences matching dominant architecture (%) | 42.22 |
| Average overlap percent | 35.64 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X2HME5 | 192-536 | 345 | KENGGFWANLPDPWQTYCRVLTCCVPGHVLLAFGIPAGPAQKAWREKIGLLSFIAVVMGFVGFLTFGFTQAVCPTPPLSVQGGQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-J9VNT4-F1 | 905-1270 | 99.10 | 83.18 | View in AlphaFoldDB ↗ |