DPCfam | MC343269
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 176 ± 28 aa |
| Residues in low-complexity regions (%) | 12.05 |
| Residues in coiled-coil regions (%) | 36.09 |
| Predicted disordered residues (%) | 52.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006B22822 | 300-441 | 142 | SLSPLAAAPGKERPMVVSRGPLLAPKDFTRGRRSPPLCGKAETKRGKTEIQPLEDELQCIGQKMQDYYSQQQELKFCQRQERLLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A9CB34-F1 | 1061-1234 | 98.90 | 61.54 | View in AlphaFoldDB ↗ |