DPCfam | MC34324
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 215 ± 28 aa |
| Residues in low-complexity regions (%) | 11.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01412 |
| Sequences matching dominant architecture (%) | 90.24 |
| Average overlap percent | 18.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E9NPF2 | 69-285 | 217 | MDKWKDLELARMKNGGNVNAKAFFETYDEYREDMSIPEKYNSAFAEDYKEKLLAVCEGREWVKPEGPRLKRAAEPVRSTKQSSYH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8N6T3-F1 | 64-280 | 100.00 | 63.42 | View in AlphaFoldDB ↗ |