DPCfam | MC343156
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Residues in low-complexity regions (%) | 1.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07286 |
| Sequences matching dominant architecture (%) | 1.59 |
| Average overlap percent | 4.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A317130 | 2-83 | 82 | MTLSFLLRSCLRSAIRSLPKAAHIRNTSSMTEGLQPASVVVLPRSLAPAFESFCQGNQGPLPLLGQSEAVKTLPQLSAVPDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5KY48-F1 | 7-87 | 98.78 | 94.77 | View in AlphaFoldDB ↗ |