DPCfam | MC343
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Residues in low-complexity regions (%) | 1.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03211 |
| Sequences matching dominant architecture (%) | 93.01 |
| Average overlap percent | 92.92 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q829M8 | 51-257 | 207 | PEATGSKAVSSTIEVSGTYDGKLKKFSGSGDLGTADQSEDQGPLFELEDGAVLKNVIIGTPAADGVHCLGSCTLQNVWWLDVGED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0CCF8-F1 | 31-219 | 97.97 | 97.16 | View in AlphaFoldDB ↗ |