DPCfam | MC342758
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 195 ± 38 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.88 |
| Average transmembrane regions | 0.64 |
| Dominant Pfam architecture(s) | PF15020 |
| Sequences matching dominant architecture (%) | 81.36 |
| Average overlap percent | 65.08 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005EDBF99 | 42-281 | 240 | KMVSELEIGCPPHRHIRVHKPTECQDYGSYIINRRSYVQENDEPPATEMVVEYDKQLYGCPIILTVKDVFKPEIDLYDEDVFVES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86XM0-F1 | 530-734 | 98.57 | 92.12 | View in AlphaFoldDB ↗ |