DPCfam | MC34251
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1361 |
|---|---|
| Mean domain length (aa) | 353 ± 56 aa |
| Residues in low-complexity regions (%) | 2.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.67 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00120 |
| Sequences matching dominant architecture (%) | 64.08 |
| Average overlap percent | 80.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6NB46 | 68-473 | 406 | LDNGATITTTMLAKDTSHKTVFPVFQAGGGFGMSEMQGGADVVMLPDPTTFRVLPWAPTTGWVLCDLYFADGRPVQFATRNIYRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P19064-F1 | 43-422 | 98.58 | 95.38 | View in AlphaFoldDB ↗ |