DPCfam | MC342063
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 258 ± 30 aa |
| Residues in low-complexity regions (%) | 19.02 |
| Residues in coiled-coil regions (%) | 14.75 |
| Predicted disordered residues (%) | 54.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00045758A0 | 511-785 | 275 | AGTYLWDEEGMEPIGTVEQCGSLESSELNSLDILNNLDSCDLDEDDLMLDIDLPEDFPCKMEACDSMTHLDRSERGSRNQGFWRK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7F0A9-F1 | 500-741 | 98.86 | 61.46 | View in AlphaFoldDB ↗ |