DPCfam | MC34177
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Residues in low-complexity regions (%) | 21.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.77 |
| Average transmembrane regions | 0.64 |
| Dominant Pfam architecture(s) | PF10708 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 37.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A04BBB1 | 96-166 | 70 | IVVLMGLVVLAILGGITAVIILIVKSQRRQPNTYQAPPPYAAASIPPGWYDDGSGAVRWYDGQRWTPHTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6YG51-F1 | 79-154 | 97.26 | 66.95 | View in AlphaFoldDB ↗ |