DPCfam | MC341754
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 229 ± 32 aa |
| Residues in low-complexity regions (%) | 4.16 |
| Residues in coiled-coil regions (%) | 1.96 |
| Predicted disordered residues (%) | 34.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003F06DAD | 3375-3638 | 264 | ALVLTLESSLITACSSGSLVSKGIFKGFCLRFAEDFETSLDDWKPDASLEIIMNACTVPEGTYEVCSRTTRKTEAGEHLQSVGKW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5S6PBY6-F1 | 1129-1334 | 97.37 | 59.70 | View in AlphaFoldDB ↗ |