DPCfam | MC341682
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 181 ± 25 aa |
| Residues in low-complexity regions (%) | 4.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.89 |
| Average transmembrane regions | 0.94 |
| Dominant Pfam architecture(s) | PF14027 |
| Sequences matching dominant architecture (%) | 97.95 |
| Average overlap percent | 35.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K5VS92 | 281-476 | 196 | QAELDEKVEELIWLGTLLMAGTSKPGRKPRLDFFLMHMVTSSLFVLSLLQVIPSIESKTTLVRAVLPVVLMYMTVRGRPRIDPAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GG41-F1 | 259-412 | 98.33 | 98.10 | View in AlphaFoldDB ↗ |