DPCfam | MC341550
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 232 ± 27 aa |
| Residues in low-complexity regions (%) | 3.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08432 |
| Sequences matching dominant architecture (%) | 0.68 |
| Average overlap percent | 4.72 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A194QRV8 | 39-308 | 270 | EANSSDQESDIETPIQKGEIRVVWHPSGTERVISEKSVGLADRSLMPGDVVRRLIAGKDTQRGYCRDIVMTAALQIVGTKHVIPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6ZPJ3-F1 | 113-350 | 99.15 | 86.31 | View in AlphaFoldDB ↗ |