DPCfam | MC341406
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Residues in low-complexity regions (%) | 0.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14367 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 44.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H5PLZ5 | 103-163 | 61 | GRKNAADPFVIAVAEVHRCMVISGEKNGGPGTPKIPYVCTQRSVKHGRFIDIIKNEGWSFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6Y0Y0-F1 | 95-153 | 96.77 | 94.07 | View in AlphaFoldDB ↗ |