DPCfam | MC341041
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1031 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01120 |
| Sequences matching dominant architecture (%) | 68.31 |
| Average overlap percent | 18.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E8V1B6 | 257-410 | 154 | PWESCMTLNDSWGYQAADDNWKSARTVIRNLITCSRDGGNYLLNIGPRGTDGSIPEESVRILTEVGKWMQTSGDCIYHNPDTCQP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QWD0-F1 | 288-433 | 97.84 | 96.55 | View in AlphaFoldDB ↗ |