DPCfam | MC340661
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Residues in low-complexity regions (%) | 2.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.62 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A011UZW3 | 12-119 | 108 | ITDRFPELAELVSIETEGFDEFLPHVVFANVFNGLAVSFLKLESYRQSDTLKRIFDMYEELASQGDEETKNLVQVTLLEYLWDES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F6I4-F1 | 27-126 | 90.68 | 95.29 | View in AlphaFoldDB ↗ |