DPCfam | MC340251
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 191 ± 25 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00359 |
| Sequences matching dominant architecture (%) | 30.12 |
| Average overlap percent | 41.91 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C3YTF0 | 2-185 | 184 | YASHERIPKKDFRHEVQAKKDVASFLGMAQLMLDMVETSLQDILDTMLEKILKDETKCTMASAKSALFTHDSGRFRLLRHFSKTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F6NGR0-F1 | 87-270 | 98.39 | 79.76 | View in AlphaFoldDB ↗ |