DPCfam | MC34009
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 230 ± 38 aa |
| Residues in low-complexity regions (%) | 5.83 |
| Residues in coiled-coil regions (%) | 0.73 |
| Predicted disordered residues (%) | 1.78 |
| Average transmembrane regions | 5.15 |
| Dominant Pfam architecture(s) | PF10323 |
| Sequences matching dominant architecture (%) | 4.35 |
| Average overlap percent | 82.7 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3NIA9 | 80-311 | 232 | VLSALTIISMLSLVLAWQVEKWPVVMQVALYCDTITGFFSMMMLYPLMCNQMLSRMYEDIWRRSFTKTRIICLVALCASLSCIAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2C9C396-F1 | 109-355 | 99.19 | 82.73 | View in AlphaFoldDB ↗ |