DPCfam | MC339732
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Residues in low-complexity regions (%) | 1.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A124EQZ8 | 6-89 | 84 | STVQGLVQGATLGRSCANFDRFRFGKTVSGDTVICNPQGDGTGLWVRAIPVIGTRLIGSSCQGITFALAAQSPDGIPLVCSSGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O07741-F1 | 32-121 | 98.82 | 92.30 | View in AlphaFoldDB ↗ |