DPCfam | MC339650
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 85 ± 15 aa |
| Residues in low-complexity regions (%) | 5.91 |
| Residues in coiled-coil regions (%) | 9.64 |
| Predicted disordered residues (%) | 33.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08544 |
| Sequences matching dominant architecture (%) | 29.17 |
| Average overlap percent | 7.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A066VJC4 | 415-518 | 104 | VLADVDTGSNTPSLVSKVLAWKKAKPEWAKQLYSVLDNSNQSLADGLLALTLGCLKNREEYEKSLDIAAGVKSAKWDELARTHPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q38F36-F1 | 288-366 | 80.90 | 92.32 | View in AlphaFoldDB ↗ |