DPCfam | MC339474
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Residues in low-complexity regions (%) | 1.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13148 |
| Sequences matching dominant architecture (%) | 97.5 |
| Average overlap percent | 7.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A076PNS9 | 304-408 | 105 | LRLAGVLQWFTAPQEMIERTSMETAIDIVQWHLVQARAGFGKLPQEALQQELARTLYDYLMRRAVKYNATATPRNTLIRGAPLSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P52124-F1 | 364-464 | 99.01 | 85.39 | View in AlphaFoldDB ↗ |