DPCfam | MC339339
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 206 ± 21 aa |
| Residues in low-complexity regions (%) | 4.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00149 |
| Sequences matching dominant architecture (%) | 43.64 |
| Average overlap percent | 9.03 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C6B687 | 144-370 | 227 | MTGAATPDGSIRIGLAHGPIQEFSEDATATNVIAPNRAALAGLDYMALGDWHGSVAVDARTYYSGAPEPDRFKHDRPGQAMVVSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F3N4-F1 | 85-290 | 97.98 | 94.20 | View in AlphaFoldDB ↗ |