DPCfam | MC339112
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 204 ± 28 aa |
| Residues in low-complexity regions (%) | 3.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.28 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00141 |
| Sequences matching dominant architecture (%) | 0.93 |
| Average overlap percent | 0.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094F7Z9 | 287-546 | 260 | MIDTVPKEVQLTPVIVPYEIKPKEIRLTIADNTTLNFAGDIRVRTTVRHASNISIVEIISKGIDNTTQTSLGTKQIFDDGTSFSR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VTM0-F1 | 285-488 | 99.51 | 92.30 | View in AlphaFoldDB ↗ |