DPCfam | MC338873
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 501 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.92 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF01933 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.4 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G2EDU4 | 176-262 | 87 | KRIYLDPDGQGYPKAIKEIKTADFLILGPGDLYSSILPCFLPKGIKEAVKESKAKKIFICPLMTKNGETAGFTAKEFCAKTEEYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9X235-F1 | 163-240 | 92.94 | 97.41 | View in AlphaFoldDB ↗ |