DPCfam | MC338796
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Residues in low-complexity regions (%) | 1.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10720 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.09 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4VCG7 | 259-367 | 109 | WAKNHTHTGSRSDFWPQLFHPINENLPGKLQNPMIENCKVISASARIYSPVLSSSWPNSTQVAAENGDWFSKWQVIGYLKKHEKD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39791-F1 | 252-308 | 52.83 | 88.89 | View in AlphaFoldDB ↗ |