DPCfam | MC338753
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 342 ± 33 aa |
| Residues in low-complexity regions (%) | 6.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00595 |
| Sequences matching dominant architecture (%) | 82.86 |
| Average overlap percent | 21.74 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9KZU9 | 1-324 | 324 | PVRVQAVDPGGPADLAGLQSLDTVLQLNGQQVEQWKCVELAHTIRNCHSEIVVLIWRLGPQLKPGFENLIRLPSHRSNYELQTPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QC69-F1 | 6-371 | 99.15 | 56.03 | View in AlphaFoldDB ↗ |