DPCfam | MC338432
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 187 ± 31 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17662 |
| Sequences matching dominant architecture (%) | 93.48 |
| Average overlap percent | 77.2 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006444837 | 32-177 | 146 | SSQIPGLSLDFQDNVEGNATGRRLGVVDTDSNYVKLAKQGGHKGLLWHEETNMPTKTNSAYKPPDWFCADSEAPSLTKRTDPGFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NEG2-F1 | 20-227 | 100.00 | 69.14 | View in AlphaFoldDB ↗ |