DPCfam | MC33837
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Residues in low-complexity regions (%) | 0.82 |
| Residues in coiled-coil regions (%) | 0.65 |
| Predicted disordered residues (%) | 28.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02463 |
| Sequences matching dominant architecture (%) | 42.86 |
| Average overlap percent | 12.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6G830 | 546-642 | 97 | NVHNIRQSETGNHKYMSLSGALEIDNSVVANCLIDQQEIETVLLIPTNAEAYNLLDEPHKVPRNCNKAFTLTGDLFFPAPNYKSY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6P9I7-F1 | 600-719 | 99.20 | 86.63 | View in AlphaFoldDB ↗ |