DPCfam | MC338051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 175 ± 22 aa |
| Residues in low-complexity regions (%) | 6.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.14 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E0L3M1 | 945-1174 | 230 | GRDKKNATMLRRLLGLSGEVSGRLRRSLSTAASRPAWAMMDNSVRLDQRVPPEPRATFRLAEPPGVSHLSVPLHLLLSPATPITE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9FJN4-F1 | 10-180 | 98.31 | 84.24 | View in AlphaFoldDB ↗ |