DPCfam | MC337821
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 230 ± 34 aa |
| Residues in low-complexity regions (%) | 0.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9NZI3 | 80-352 | 273 | STIQDSEATDPLSTGPSQSVRQLYSTGNPSSTTLLSVDIHECILSAPKSSYKDFEPPNGMSIMSEWRALQKLSPYMDASKTDECA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q4B1-F1 | 114-347 | 99.12 | 89.18 | View in AlphaFoldDB ↗ |