DPCfam | MC337669
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Residues in low-complexity regions (%) | 4.19 |
| Residues in coiled-coil regions (%) | 0.37 |
| Predicted disordered residues (%) | 14.97 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T2MBZ3 | 2073-2142 | 70 | KDEAVHLYAWSQLIVSMLELLLGLPTLQFKSVLPAVFPAVTSLINNVHDPKVRQLVCDVVRRCGSIYGII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8PYH2-F1 | 2074-2152 | 89.77 | 80.04 | View in AlphaFoldDB ↗ |