DPCfam | MC337397
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 4911 |
|---|---|
| Mean domain length (aa) | 251 ± 37 aa |
| Residues in low-complexity regions (%) | 4.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00263 |
| Sequences matching dominant architecture (%) | 56.38 |
| Average overlap percent | 69.17 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X1LZ64 | 1-161 | 161 | PQITTISGEVAGMYAVQDIPYVKITKREEEGEKITEVEPKYSTVGMILQVLPRIVGEDLVQMSILPIVAELLGYETFKVDTILQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45778-F1 | 344-601 | 97.35 | 89.49 | View in AlphaFoldDB ↗ |