DPCfam | MC337280
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Residues in low-complexity regions (%) | 3.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.53 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04113 |
| Sequences matching dominant architecture (%) | 94.15 |
| Average overlap percent | 54.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W2PPQ7 | 28-201 | 174 | DSLREELVITPLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSVWIN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q969N2-F1 | 31-228 | 98.05 | 92.47 | View in AlphaFoldDB ↗ |