DPCfam | MC337103
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 588 ± 54 aa |
| Residues in low-complexity regions (%) | 7.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.33 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF02121 |
| Sequences matching dominant architecture (%) | 83.33 |
| Average overlap percent | 42.46 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7PQR9 | 1-657 | 657 | MLLKEYRIPLPLSVDEYRVAQLYMIAKKSREESKGAGSGVEILVNEPYEDGPGGCGQYTHKIYHVGSHLPGWFKALLPKSALTVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9BZ72-F1 | 1-572 | 99.83 | 72.13 | View in AlphaFoldDB ↗ |