DPCfam | MC336891
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04412 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 24.41 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E6SD52 | 352-429 | 78 | RSVLAEAASRGHIAALEVAGVQIVVDTCTYVTPILGADVRVVMTNSGKWAHYAPANLGVAVVLGSLAECVASARAGRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I485-F1 | 488-567 | 96.30 | 96.72 | View in AlphaFoldDB ↗ |