DPCfam | MC33686
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 213 ± 27 aa |
| Residues in low-complexity regions (%) | 3.16 |
| Residues in coiled-coil regions (%) | 0.51 |
| Predicted disordered residues (%) | 3.05 |
| Average transmembrane regions | 4.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R4WQX9 | 6-215 | 210 | RNTAIFAGIFTLLQGVIWAFLAVYSVGIYACTFDYPYYNSNENTVGNIFFYSYLQGSCRLDPTKPIPIMNPPHRTYAIMLTYGIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VZZ0-F1 | 10-233 | 98.18 | 86.90 | View in AlphaFoldDB ↗ |