DPCfam | MC33684
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Residues in low-complexity regions (%) | 8.59 |
| Residues in coiled-coil regions (%) | 0.36 |
| Predicted disordered residues (%) | 1.7 |
| Average transmembrane regions | 3.16 |
| Dominant Pfam architecture(s) | PF03350 |
| Sequences matching dominant architecture (%) | 97.93 |
| Average overlap percent | 77.76 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000838A723 | 81-224 | 144 | RYLVSLRFVLLVAAIGTAVGAIIMFLQASLQMLGAAIDLLKGEEPKIVTAMVMGATDTYLFGIVLVIFSYAIAFGFVFYSGADRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5Z9G6-F1 | 95-252 | 100.00 | 79.79 | View in AlphaFoldDB ↗ |