DPCfam | MC33646
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 254 ± 20 aa |
| Residues in low-complexity regions (%) | 24.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 73.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05110 |
| Sequences matching dominant architecture (%) | 84.21 |
| Average overlap percent | 59.44 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6WMU1 | 241-497 | 257 | QTFPPSLSSKTSAMPQKPTAYVRPMDGQDQVPSESPYIKPLQEDYHEESYTKQNLRIEAMTNLTNIKMHAQKLDQTLSNEAQCVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P51816-F1 | 257-539 | 99.26 | 40.64 | View in AlphaFoldDB ↗ |