DPCfam | MC336419
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Residues in low-complexity regions (%) | 1.58 |
| Residues in coiled-coil regions (%) | 70.72 |
| Predicted disordered residues (%) | 30.07 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00447 |
| Sequences matching dominant architecture (%) | 0.61 |
| Average overlap percent | 11.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C7LLM9 | 166-223 | 58 | INSVVNGIAAIKRHQQAISADLSALKQSNDALWKEAVLARERHAKHQDTINRILKFLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q00613-F1 | 137-211 | 98.68 | 84.88 | View in AlphaFoldDB ↗ |