DPCfam | MC336227
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Residues in low-complexity regions (%) | 2.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03367 |
| Sequences matching dominant architecture (%) | 93.68 |
| Average overlap percent | 20.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6LK44 | 350-427 | 78 | FFMGDSASNTERSQIEIFLEQFNDILSLKKVVTLVLDDPAGNSYIQSLNAPLEDPRLTKEFYERTFEQNDELGLNDMK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O75312-F1 | 373-451 | 100.00 | 86.86 | View in AlphaFoldDB ↗ |