DPCfam | MC335919
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2161 |
|---|---|
| Mean domain length (aa) | 106 ± 31 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02023 |
| Sequences matching dominant architecture (%) | 85.51 |
| Average overlap percent | 83.63 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4AHQ9 | 54-192 | 139 | DESIDEMDAYINRFERFAQAQGWQRLPADKKNEYEALRDSLLKSYNLTEEGFHNRFRNSKPIFKEIPQQFIARLEGYFNRWIELS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0CG71-F1 | 741-827 | 52.60 | 87.43 | View in AlphaFoldDB ↗ |