DPCfam | MC335801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Residues in low-complexity regions (%) | 1.06 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 25.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02898 |
| Sequences matching dominant architecture (%) | 97.92 |
| Average overlap percent | 31.61 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A074S5J7 | 108-195 | 88 | LERTADEVWSEAEEYLAEYYKENKLPVCDLLARLEQVEQDLRSQGYYTHTFDELSFGVKTAWRNARRCIMRSQWSTMQTVDCRGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O61608-F1 | 163-248 | 98.84 | 91.44 | View in AlphaFoldDB ↗ |