DPCfam | MC335500
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.1 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04054 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1KFW3 | 2406-2514 | 109 | MRLPDPFTPNLKIDSLPEIIQSPKGASNTLSALATVPFRKELDSYLRTRSPVTFLCELRGYLQNPNGSDGNRYNIPLINALVLFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6JJP2-F1 | 2190-2297 | 99.09 | 86.49 | View in AlphaFoldDB ↗ |