DPCfam | MC334982
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.58 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF09339 |
| Sequences matching dominant architecture (%) | 9.09 |
| Average overlap percent | 41.27 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q4H2H3 | 168-255 | 88 | GLYVVGAISVLNAAAITHYPELGHRYGFAHTIPPDDIRRPASLQAVAEIDGFPYPTIWRHATAARLAGALRRVPDGYLLGTRFMD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F0C3-F1 | 22-66 | 46.88 | 91.16 | View in AlphaFoldDB ↗ |