DPCfam | MC334946
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 126 ± 7 aa |
| Residues in low-complexity regions (%) | 0.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.98 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF00801 |
| Sequences matching dominant architecture (%) | 10.26 |
| Average overlap percent | 41.83 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q4T884 | 912-1033 | 122 | HLEVVPVVGRNQEVNLSAVVVPADANLTVFYWWIGEQLQPKLTLHNSLLVRLDQSGEVSVTVQASNGRSMVQDTQTVRVYDDFQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96PQ0-F1 | 869-995 | 99.22 | 89.41 | View in AlphaFoldDB ↗ |