DPCfam | MC334681
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 296 ± 35 aa |
| Residues in low-complexity regions (%) | 2.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.69 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF11951 |
| Sequences matching dominant architecture (%) | 23.94 |
| Average overlap percent | 46.98 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K8LJH7 | 530-842 | 312 | RFFEYLDAGLNKFRNELARSETYLEDGTMTAGLLLCTIGTMHGIPWSMHLRGMHGILQLDDVDNPRNEKTPFRAHLFEVMGIMDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GAG5-F1 | 36-313 | 99.34 | 88.00 | View in AlphaFoldDB ↗ |