DPCfam | MC33417
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 137 ± 21 aa |
| Residues in low-complexity regions (%) | 13.18 |
| Residues in coiled-coil regions (%) | 0.24 |
| Predicted disordered residues (%) | 52.1 |
| Average transmembrane regions | 0.22 |
| Dominant Pfam architecture(s) | PF03999 |
| Sequences matching dominant architecture (%) | 95.16 |
| Average overlap percent | 34.74 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D6L2A1 | 830-1000 | 171 | NLKRAEKARLIITKIPAVVDSLMSRTLAWESERKKPFLYDGARLVAVLEEHKQARLRQEEERRRLREQKKLRTLLSEKEAMPHLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6L2A1-F1 | 832-1000 | 99.29 | 59.17 | View in AlphaFoldDB ↗ |