DPCfam | MC333496
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01979 |
| Sequences matching dominant architecture (%) | 77.53 |
| Average overlap percent | 19.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A101I1C4 | 197-253 | 57 | EEMIPFVAQEKLADFIDVFCEKGVFTKDESVQILEKGIEYGLKARVHADEIEYSGGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6TSW9-F1 | 204-270 | 100.00 | 96.49 | View in AlphaFoldDB ↗ |